Carrier of the growing fatty acid chain in fatty acid biosynthesis. Acyl carrier protein 70 MSDIADRVKKIVVEHLGVEEEKVTETTSFIDDLGADSLDTVELVMAFEEEFGIEIPDDAAETIQTFGDAP ACP_RHOSH acpP